PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family BES1
Protein Properties Length: 332aa    MW: 36297.6 Da    PI: 9.6837
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00448genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.73.8e-65171581144
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr..kgskpleeaeaagssasaspesslqss 97 
                 ++++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqG+y+lpk++DnneVlkALc+eAGwvve+DGttyr  +g+kpl   ++ag+s++++p ss+++s
  AA31G00448  17 AAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKALCAEAGWVVEEDGTTYRkyQGCKPL-PGDIAGTSSRVTPYSSQNLS 114
                 5899******************************************************************888*****.******************** PP

      DUF822  98 lkssalaspvesysaspksssfpspssldsislasaasllpvlsvls 144
                 + ssa++sp++sy+ sp+sssfpsps+++ ++++   +++p+l++ +
  AA31G00448 115 PLSSAFQSPIPSYQVSPSSSSFPSPSRVEPNNIS---TFFPFLRNGG 158
                 *******************************996...7888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.8E-5919147IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MTLDGATSTS AAAAAAAAAR RKPSWREREN NRRRERRRRA VAAKIYTGLR AQGDYNLPKH  60
CDNNEVLKAL CAEAGWVVEE DGTTYRKYQG CKPLPGDIAG TSSRVTPYSS QNLSPLSSAF  120
QSPIPSYQVS PSSSSFPSPS RVEPNNISTF FPFLRNGGIP SSLPSLRISN SCPVTPPVSS  180
PTSKNPKPLP NWDSIAKQSM AIAKQSMSSF NYPFYAASAP ASPTHRQFHT PATIPECDES  240
DSSTVDSGHW ISFQKFTQQP FPTSMVPTSP TFNLVKPAPQ QMSPNAALQE IGQSSEFKFE  300
NSQVKPWEGE RIHDVGMEDL ELTLGNRKKA RG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11938RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0872570.0AY087257.1 Arabidopsis thaliana clone 33367 mRNA, complete sequence.
GenBankBT0154540.0BT015454.1 Arabidopsis thaliana At1g75080 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002887573.10.0At1g75080/F9E10_7
SwissprotQ8S3070.0BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLD7KSK20.0D7KSK2_ARALL; At1g75080/F9E10_7
STRINGfgenesh2_kg.2__1777__AT1G75080.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24722772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-159BES1 family protein